PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00107075001
Common NameGSBRNA2T00107075001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 750aa    MW: 85839.9 Da    PI: 8.3153
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00107075001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.81.2e-2885139155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          k+r++Wt +LH++Fve v++LGG+ kAtPk+il+lm  + Lt+++vkSHLQkYR+
  GSBRNA2T00107075001  85 KTRVKWTANLHDKFVESVNHLGGPMKATPKQILKLMRTHELTIYQVKSHLQKYRT 139
                          68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.30384142IPR017930Myb domain
TIGRFAMsTIGR015576.3E-2385140IPR006447Myb domain, plants
SuperFamilySSF466899.85E-1485139IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-2485140IPR009057Homeodomain-like
PfamPF002492.2E-687138IPR001005SANT/Myb domain
PfamPF025367.6E-7337467IPR003690Transcription termination factor, mitochondrial/chloroplastic
SMARTSM0073392351381IPR003690Transcription termination factor, mitochondrial/chloroplastic
SMARTSM007334.6386417IPR003690Transcription termination factor, mitochondrial/chloroplastic
SMARTSM00733530490521IPR003690Transcription termination factor, mitochondrial/chloroplastic
SMARTSM00733620607637IPR003690Transcription termination factor, mitochondrial/chloroplastic
PfamPF025365.2E-17623725IPR003690Transcription termination factor, mitochondrial/chloroplastic
SMARTSM007330.11642673IPR003690Transcription termination factor, mitochondrial/chloroplastic
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003690Molecular Functiondouble-stranded DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 750 aa     Download sequence    Send to blast
MKFGRRHGSD DDHSSDNDHS SDDMCSEHVT HCCKCYDISQ IFSSDTRQST SLTKQSFECV  60
ETDISTEPSA RSSLASEFTN SPCIKTRVKW TANLHDKFVE SVNHLGGPMK ATPKQILKLM  120
RTHELTIYQV KSHLQKYRTQ KHVQNSIQGT SLKEEKIHLE GSGITEFIRL QDKVGQHLQE  180
QLEVSMTLVR NPSRFTTLLK RLSHLSVENP FTPLSSATQK PRSFATQRTR NGIRVTPTIR  240
KMAEEAMLDY FYSTRSLQYM VAESMSKNSP IFIENLLKKV SCVSASDINQ SITKHLRFHP  300
VNEFEPFLES SGLKPDEYTH LIPSGEIFLN ELLLENHRVL CYCGVDPKKI GKIFEEARDV  360
FGYETGVLAS KIKVYEDFGF SRLFLSKLIA CCPRMLVGDT DMELVRVVEK LRAIGIDSDW  420
VMKNLSEEVS YDWSSVHCAL TLLRVICNDE DELYALIKNH PRLIFESSGR WTLILSGFET  480
KLGLSARELY SLFQKLPQMQ VEKCVSNLRR CFLFLKEIDM EDDEIQKVFR SHSWWISSCT  540
LKKTSSLLVN LKAYKTRVCK VVKENPEEMK KWTMGSKVHP LPATEVYLDS KAMKTQFLLD  600
LGYVEGSEEM ERAGKSFRGR GSELKERFEV LVRFGLDEED VKEMVKASPN ILTQASDVLE  660
TKVRFLVTEL GYPLSTLVAF PSCLKFTLER MKVRFAMFAW LKARGKADPK LAVSTLLACS  720
DKDFARYFVS RHPDGPKHLE DLKKKQQLL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00107075001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013612668.10.0PREDICTED: uncharacterized protein LOC106319015
TrEMBLA0A078EA210.0A0A078EA21_BRANA; BnaC09g48750D protein
STRINGBra009230.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM512923
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.22e-23G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]